PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G163813_P02
Common Namepco114323, ZEAMMB73_807788
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family SBP
Protein Properties Length: 331aa    MW: 36182.3 Da    PI: 8.8277
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G163813_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.3e-4161138178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +CqvegC  dls++keyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  GRMZM2G163813_P02  61 RCQVEGCGLDLSRVKEYHRKHRVCEAHTKSPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 138
                        6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3257123IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.42859136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3960141IPR004333Transcription factor, SBP-box
PfamPF031103.0E-3162135IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEWTAPKRAA SPPSPPLLWD WGGDHAGATG SGSGSSGDAP ARRGGREREA KRARADDGEV  60
RCQVEGCGLD LSRVKEYHRK HRVCEAHTKS PRVVVAGQER RFCQQCSRFH ALSEFDQKKR  120
SCRRRLSDHN ARRRKPQPDA FAFASARLPS SSFDDRRQIS FVWNKAPVSH PFTSPWDSSS  180
ELPHAKEIRE VSTKVGTITG QVHLDKSYVS NAVPSLTHGK DEPWPMKGPD MSIAASKFDG  240
APDLQRALSL LSVGACGLPD PVHQTSCVIQ FTSASENSGD LHLSHGANSG LASCGDGQHI  300
ASQPQAQLVR FTMDTSNSVY EPSFFSVNQI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-25621351184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117134KKRSCRRRLSDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.989110.0ear| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G163813
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G163813_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0881830.0BT088183.1 Zea mays full-length cDNA clone ZM_BFc0047E05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008676559.10.0PREDICTED: uncharacterized protein LOC100193507 isoform X1
SwissprotQ653Z52e-95SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLC4JBI60.0C4JBI6_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
STRINGGRMZM2G163813_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-45squamosa promoter binding protein-like 2